SCOPe 2.06: Domain d1jznb_: 1jzn B:

Lineage for d1jznb_ (1jzn B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Galactose-specific C-type lectin [90061] (1 species)

7. Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)

8. Domain d1jznb_: 1jzn B: [84263]
   complexed with ca, cl, na

Details for d1jznb_

PDB Entry: 1jzn, 2.2 Å

PDB Description: crystal structure of a galactose-specific c-type lectin

PDB Compounds: (B:) Galactose-specific lectin

SCOPe Domain Sequences for d1jznb_:

Sequence; same for both SEQRES and ATOM records:

>d1jznb_ d.169.1.1 (B:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
qvceskdaflcqckf

Timeline for d1jznb_:

• d1jznb_ first appeared in SCOP 1.65
  
• d1jznb_ appears in SCOPe 2.05
  
• d1jznb_ appears in SCOPe 2.07
  
• d1jznb_ appears in the current release, SCOPe 2.08