PDB entry 1jln

View 1jln on RCSB PDB site
Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7
Class: hydrolase
Keywords: protein tyrosine phosphatase, PTP-SL, PTPBR7, ERK2-MAP kinase regulation, HYDROLASE
Deposited on 2001-07-16, released 2001-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Tyrosine Phosphatase, receptor type, R
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62132 (2-296)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1jlna1, d1jlna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jlnA (A:)
    gsprekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtkn
    ryktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqm
    vwqedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgs
    htqhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfi
    atsigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv