Lineage for d1jlna1 (1jln A:254-548)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483190Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2483235Protein Tyrosine phosphatase [52806] (7 species)
  7. 2483529Species Mouse (Mus musculus), ptp-sl/br7 [TaxId:10090] [64051] (1 PDB entry)
  8. 2483530Domain d1jlna1: 1jln A:254-548 [63172]
    Other proteins in same PDB: d1jlna2

Details for d1jlna1

PDB Entry: 1jln (more details), 1.81 Å

PDB Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7
PDB Compounds: (A:) Protein Tyrosine Phosphatase, receptor type, R

SCOPe Domain Sequences for d1jlna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlna1 c.45.1.2 (A:254-548) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]}
prekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtknry
ktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqmvw
qedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgsht
qhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfiat
sigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv

SCOPe Domain Coordinates for d1jlna1:

Click to download the PDB-style file with coordinates for d1jlna1.
(The format of our PDB-style files is described here.)

Timeline for d1jlna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlna2