PDB entry 1jfi
View 1jfi on RCSB PDB site
Description: Crystal Structure of the NC2-TBP-DNA Ternary Complex
Class: transcription/DNA
Keywords: Histone, H2A/H2B, TBP, TATA-DNA, transcription initiation, NC2, Negative Cofactor, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSCRIPTION/DNA COMPLEX
Deposited on
2001-06-20, released
2001-07-11
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.233
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Transcription Regulator NC2 alpha chain
Species: Homo sapiens [TaxId:9606]
Gene: NC2 alpha (DRAP1)
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1jfia_ - Chain 'B':
Compound: Transcription Regulator NC2 beta chain
Species: Homo sapiens [TaxId:9606]
Gene: NC2 beta (Dr1)
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1jfib_ - Chain 'C':
Compound: tata-box-binding protein (tbp)
Species: Homo sapiens [TaxId:9606]
Gene: tbp
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1jfic1, d1jfic2 - Chain 'D':
Compound: 5'-d(*tp*tp*gp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*tp*cp*c)-3'
- Chain 'E':
Compound: 5'-d(*g*gp*ap*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*cp*ap*a)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1jfiA (A:)
mpskkkkynarfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsr
naktmttshlkqcielegdpaankarkeaelaaataeq
Sequence, based on observed residues (ATOM records): (download)
>1jfiA (A:)
arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrtmttshlkq
cie
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1jfiB (B:)
gphmasssgndddltipraainkmiketlpnvrvandarelvvncctefihlisseanei
cnksekktispehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeee
llrqqqelfakarqqqaelaqqewlqmqqaaqqaqlaaasasasnqagssqdeeddddi
Sequence, based on observed residues (ATOM records): (download)
>1jfiB (B:)
ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
arqqqaelaqqewlq
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1jfiC (C:)
gshmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalif
ssgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglv
lthqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkg
frktt
Sequence, based on observed residues (ATOM records): (download)
>1jfiC (C:)
shmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifs
sgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvl
thqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgf
rkt
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.