PDB entry 1j83

View 1j83 on RCSB PDB site
Description: structure of fam17 carbohydrate binding module from clostridium cellulovorans
Class: hydrolase
Keywords: carbohydrate binding module, hydrolase
Deposited on 2001-05-20, released 2001-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta glucanase engf
    Species: Clostridium cellulovorans [TaxId:1493]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94622
      • modified residue (85)
      • modified residue (159)
    Domains in SCOPe 2.06: d1j83a_
  • Chain 'B':
    Compound: endo-1,4-beta glucanase engf
    Species: Clostridium cellulovorans [TaxId:1493]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94622 (0-179)
      • modified residue (85)
      • modified residue (159)
    Domains in SCOPe 2.06: d1j83b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j83A (A:)
qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j83B (B:)
qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk