SCOPe 2.06: Domain d1j83b_: 1j83 B:

Lineage for d1j83b_ (1j83 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.12: Family 17 carbohydrate binding module, CBM17 [69219] (1 protein)
   automatically mapped to Pfam PF03424

6. Protein Endo-1,4-beta glucanase EngF [69220] (1 species)

7. Species Clostridium cellulovorans [TaxId:1493] [69221] (2 PDB entries)

8. Domain d1j83b_: 1j83 B: [66431]
   CASP4
   complexed with ca

Details for d1j83b_

PDB Entry: 1j83, 1.7 Å

PDB Description: structure of fam17 carbohydrate binding module from clostridium cellulovorans

PDB Compounds: (B:) endo-1,4-beta glucanase engf

SCOPe Domain Sequences for d1j83b_:

Sequence; same for both SEQRES and ATOM records:

>d1j83b_ b.18.1.12 (B:) Endo-1,4-beta glucanase EngF {Clostridium cellulovorans [TaxId: 1493]}
qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk

Timeline for d1j83b_:

• d1j83b_ first appeared in SCOP 1.59
  
• d1j83b_ appears in SCOPe 2.05
  
• d1j83b_ appears in SCOPe 2.07
  
• d1j83b_ appears in the current release, SCOPe 2.08