PDB entry 1iuf

View 1iuf on RCSB PDB site
Description: low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein
Deposited on 2002-03-04, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iufA (A:)
gihmgkikrraitehekralrhyffqlqnrsgqqdliewfrekfgkdisqpsvsqilssk
ysyldntvekpwdvkrnrppkyplleaalfewqvqqgddatlsgetikraaailwhkipe
yqdqpvpnfsngwlegfrkrhilh