SCOP 1.61: Domain d1iufa2: 1iuf A:76-141

Lineage for d1iufa2 (1iuf A:76-141)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.7: Centromere-binding [46756] (2 proteins)

6. Protein Ars-binding protein 1, ABP1 [74670] (1 species)

7. Species Fission yeast (Shizosaccharomices pombe) [74671] (1 PDB entry)

8. Domain d1iufa2: 1iuf A:76-141 [71440]

Details for d1iufa2

PDB Entry: 1iuf

PDB Description: low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein

SCOP Domain Sequences for d1iufa2:

Sequence; same for both SEQRES and ATOM records:

>d1iufa2 a.4.1.7 (A:76-141) Ars-binding protein 1, ABP1 {Fission yeast (Shizosaccharomices pombe)}
ppkyplleaalfewqvqqgddatlsgetikraaailwhkipeyqdqpvpnfsngwlegfr
krhilh

Timeline for d1iufa2:

• d1iufa2 is new in SCOP 1.61
  
• d1iufa2 appears in SCOP 1.63
  
• d1iufa2 appears in the current release, SCOPe 2.08