PDB entry 1i5k

View 1i5k on RCSB PDB site
Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein
Class: blood clotting
Keywords: Human Plasminogen Kringle-2, Kringles, VEK-30, BLOOD CLOTTING
Deposited on 2001-02-27, released 2001-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plasminogen
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00747
    • engineered (7)
    • engineered (59)
    • engineered (75)
  Domains in SCOPe 2.07: d1i5ka_
• Chain 'B':
  Compound: plasminogen
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00747 (3-End)
    • cloning artifact (2)
    • engineered (7)
    • engineered (59)
    • engineered (75)
  Domains in SCOPe 2.07: d1i5kb1, d1i5kb2
• Chain 'C':
  Compound: m protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49054
• Chain 'D':
  Compound: m protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49054
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1i5kA (A:)
  fseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrd
  lrpwcfttdpnkrweycdiprcaa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1i5kA (A:)
  ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
  wcfttdpnkrweycdiprc
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1i5kB (B:)
  fseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrd
  lrpwcfttdpnkrweycdiprcaa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1i5kB (B:)
  eecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlr
  pwcfttdpnkrweycdiprc
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.