PDB entry 1hwt
View 1hwt on RCSB PDB site
Description: structure of a hap1/DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein
Class: gene regulation/DNA
Keywords: transcription factor, asymmetry, gal4, complex activator/DNA
Deposited on
1998-09-17, released
1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated
1999-11-10, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.246
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: DNA (5'-d(*gp*cp*gp*cp*tp*ap*tp*tp*ap*tp*cp*gp*cp*tp*ap*tp*tp*ap*gp*c)-3')
Species: synthetic, synthetic
- Chain 'B':
Compound: DNA (5'-d(*gp*cp*tp*ap*ap*tp*ap*gp*cp*gp*ap*tp*ap*ap*tp*ap*gp*cp*gp*c)-3')
Species: synthetic, synthetic
- Chain 'C':
Compound: protein (heme activator protein)
Species: Saccharomyces cerevisiae
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.55: d1hwtc1, d1hwtc2 - Chain 'D':
Compound: protein (heme activator protein)
Species: Saccharomyces cerevisiae
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.55: d1hwtd1, d1hwtd2 - Chain 'E':
Compound: DNA (5'-d(*gp*cp*gp*cp*tp*ap*tp*tp*ap*tp*cp*gp*cp*tp*ap*tp*tp*ap*gp*c)-3')
Species: synthetic, synthetic
- Chain 'F':
Compound: DNA (5'-d(*gp*cp*tp*ap*ap*tp*ap*gp*cp*gp*ap*tp*ap*ap*tp*ap*gp*cp*gp*c)-3')
Species: synthetic, synthetic
- Chain 'G':
Compound: protein (heme activator protein)
Species: Saccharomyces cerevisiae
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.55: d1hwtg1, d1hwtg2 - Chain 'H':
Compound: protein (heme activator protein)
Species: Saccharomyces cerevisiae
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.55: d1hwth1, d1hwth2 - Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1hwtC (C:)
riplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnelkklr
ervkslektl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1hwtD (D:)
rkrnriplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnev
kklrervkslektl
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1hwtG (G:)
riplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnelkklr
ervkslektl
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1hwtH (H:)
krnriplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnevk
klrervkslektl