PDB entry 1hwt

View 1hwt on RCSB PDB site
Description: structure of a hap1/DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein
Class: gene regulation/DNA
Keywords: transcription factor, asymmetry, gal4, complex activator/DNA
Deposited on 1998-09-17, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.246
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*gp*cp*gp*cp*tp*ap*tp*tp*ap*tp*cp*gp*cp*tp*ap*tp*tp*ap*gp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'B':
  Compound: DNA (5'-d(*gp*cp*tp*ap*ap*tp*ap*gp*cp*gp*ap*tp*ap*ap*tp*ap*gp*cp*gp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: protein (heme activator protein)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12351
  Domains in SCOP 1.55: d1hwtc1, d1hwtc2
• Chain 'D':
  Compound: protein (heme activator protein)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12351 (0-End)
  Domains in SCOP 1.55: d1hwtd1, d1hwtd2
• Chain 'E':
  Compound: DNA (5'-d(*gp*cp*gp*cp*tp*ap*tp*tp*ap*tp*cp*gp*cp*tp*ap*tp*tp*ap*gp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: DNA (5'-d(*gp*cp*tp*ap*ap*tp*ap*gp*cp*gp*ap*tp*ap*ap*tp*ap*gp*cp*gp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'G':
  Compound: protein (heme activator protein)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12351
  Domains in SCOP 1.55: d1hwtg1, d1hwtg2
• Chain 'H':
  Compound: protein (heme activator protein)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12351
  Domains in SCOP 1.55: d1hwth1, d1hwth2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hwtC (C:)
  riplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnelkklr
  ervkslektl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hwtD (D:)
  rkrnriplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnev
  kklrervkslektl
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hwtG (G:)
  riplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnelkklr
  ervkslektl
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hwtH (H:)
  krnriplscticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnevk
  klrervkslektl