PDB entry 1hun

View 1hun on RCSB PDB site
Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Class: cytokine(chemotactic)
Keywords: cytokine(chemotactic)
Deposited on 1994-01-31, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human macrophage inflammatory protein 1 beta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13236 (0-68)
  Domains in SCOPe 2.07: d1huna_
• Chain 'B':
  Compound: human macrophage inflammatory protein 1 beta
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13236 (0-68)
  Domains in SCOPe 2.07: d1hunb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hunA (A:)
  apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
  eyvydleln
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hunB (B:)
  apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
  eyvydleln