Lineage for d1hunb_ (1hun B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536144Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2536218Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2536242Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (6 PDB entries)
  8. 2536249Domain d1hunb_: 1hun B: [37400]

Details for d1hunb_

PDB Entry: 1hun (more details)

PDB Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi- dimensional nmr: a novel chemokine dimer
PDB Compounds: (B:) human macrophage inflammatory protein 1 beta

SCOPe Domain Sequences for d1hunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hunb_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydleln

SCOPe Domain Coordinates for d1hunb_:

Click to download the PDB-style file with coordinates for d1hunb_.
(The format of our PDB-style files is described here.)

Timeline for d1hunb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1huna_