PDB entry 1htn

View 1htn on RCSB PDB site
Description: human tetranectin, a trimeric plasminogen binding protein with an alpha-helical coiled coil
Deposited on 1997-05-28, released 1997-12-03
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htn_ (-)
    lksrldtlsqevallkeqqalqtvclkgtkvhmkcflaftqtktfheasedcisrggtls
    tpqtgsendalyeylrqsvgneaeiwlglndmaaegtwvdmtgariayknweteitaqpd
    ggktencavlsgaangkwfdkrcrdqlpyicqfgiv