PDB entry 1h6v

View 1h6v on RCSB PDB site
Description: mammalian thioredoxin reductase
Class: oxidoreductase
Keywords: oxidoreductase, pyridine nucleotide-disulfide oxidoreductase, flavoprotein
Deposited on 2001-06-27, released 2001-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22555
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin reductase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89049 (Start-496)
      • conflict (51)
      • engineered mutation (496)
    • PDB 1H6V (497-498)
    Domains in SCOPe 2.07: d1h6va1, d1h6va2, d1h6va3
  • Chain 'B':
    Compound: thioredoxin reductase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89049
      • conflict (51)
    • PDB 1H6V
    Domains in SCOPe 2.07: d1h6vb1, d1h6vb2, d1h6vb3
  • Chain 'C':
    Compound: thioredoxin reductase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89049
      • conflict (51)
    • PDB 1H6V
    Domains in SCOPe 2.07: d1h6vc1, d1h6vc2, d1h6vc3
  • Chain 'D':
    Compound: thioredoxin reductase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89049
      • conflict (51)
    • PDB 1H6V
    Domains in SCOPe 2.07: d1h6vd1, d1h6vd2, d1h6vd3
  • Chain 'E':
    Compound: thioredoxin reductase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89049 (Start-496)
      • conflict (51)
      • engineered mutation (496)
    • PDB 1H6V (497-498)
    Domains in SCOPe 2.07: d1h6ve1, d1h6ve2, d1h6ve3
  • Chain 'F':
    Compound: thioredoxin reductase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89049 (Start-496)
      • conflict (51)
      • engineered mutation (496)
    • PDB 1H6V (497-498)
    Domains in SCOPe 2.07: d1h6vf1, d1h6vf2, d1h6vf3
  • Heterogens: FAD, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6vA (A:)
    mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
    nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
    rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
    ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
    eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
    gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
    stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
    cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
    tlsvtkrsggdilqsgccg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6vA (A:)
    sydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkkl
    mhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvyen
    aygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeycissddlfslpyc
    pgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehmeehgikfir
    qfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrtigletvgvki
    nektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcdydn
    vpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvicnl
    kdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtkrsg
    gdilqsgccg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h6vB (B:)
    mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
    nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
    rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
    ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
    eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
    gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
    stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
    cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
    tlsvtkrsggdilqsgccg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6vB (B:)
    ksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkk
    lmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvye
    naygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeycissddlfslpy
    cpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehmeehgikfi
    rqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrtigletvgvk
    inektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcdyd
    nvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvicn
    lkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtkrs
    ggdilqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h6vC (C:)
    mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
    nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
    rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
    ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
    eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
    gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
    stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
    cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
    tlsvtkrsggdilqsgccg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6vC (C:)
    dliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkklmhqa
    allgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvyenaygk
    figphkimatnnkgkekvysaerfliatgerprylgipgdkeycissddlfslpycpgkt
    lvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehmeehgikfirqfvp
    tkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrtigletvgvkinekt
    gkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcdydnvptt
    vftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvicnlkdne
    rvvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtkrsggdil
    qs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h6vD (D:)
    mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
    nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
    rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
    ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
    eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
    gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
    stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
    cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
    tlsvtkrsggdilqsgccg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6vD (D:)
    ksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkk
    lmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvye
    naygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeycissddlfslpy
    cpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehmeehgikfi
    rqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrtigletvgvk
    inektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcdyd
    nvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvicn
    lkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtkrs
    ggdilqs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1h6vE (E:)
    mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
    nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
    rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
    ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
    eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
    gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
    stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
    cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
    tlsvtkrsggdilqsgccg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6vE (E:)
    ksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkk
    lmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvye
    naygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeycissddlfslpy
    cpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehmeehgikfi
    rqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrtigletvgvk
    inektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcdyd
    nvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvicn
    lkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtkrs
    ggdilqsgccg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1h6vF (F:)
    mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
    nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
    rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
    ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
    eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
    gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
    stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
    cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
    tlsvtkrsggdilqsgccg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6vF (F:)
    sydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkkl
    mhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvyen
    aygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeycissddlfslpyc
    pgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehmeehgikfir
    qfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrtigletvgvki
    nektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcdydn
    vpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvicnl
    kdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtkrsg
    gdilqsgccg