Lineage for d1h6ve1 (1h6v E:9-170,E:293-366)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850063Protein Mammalian thioredoxin reductase, N- and C-terminal domain [418944] (1 species)
  7. 2850064Species Norway rat (Rattus norvegicus) [TaxId:10116] [419400] (1 PDB entry)
  8. 2850069Domain d1h6ve1: 1h6v E:9-170,E:293-366 [60705]
    Other proteins in same PDB: d1h6va2, d1h6va3, d1h6vb2, d1h6vb3, d1h6vc2, d1h6vc3, d1h6vd2, d1h6vd3, d1h6ve2, d1h6ve3, d1h6vf2, d1h6vf3
    complexed with fad, ndp
    has additional insertions and/or extensions that are not grouped together

Details for d1h6ve1

PDB Entry: 1h6v (more details), 3 Å

PDB Description: mammalian thioredoxin reductase
PDB Compounds: (E:) thioredoxin reductase

SCOPe Domain Sequences for d1h6ve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ve1 c.3.1.5 (E:9-170,E:293-366) Mammalian thioredoxin reductase, N- and C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkk
lmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvye
naygkfigphkimatnnkgkekvysaerfliatgerprylgiXrdsctrtigletvgvki
nektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcd

SCOPe Domain Coordinates for d1h6ve1:

Click to download the PDB-style file with coordinates for d1h6ve1.
(The format of our PDB-style files is described here.)

Timeline for d1h6ve1: