Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Mammalian thioredoxin reductase, N- and C-terminal domain [418944] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [419400] (1 PDB entry) |
Domain d1h6ve1: 1h6v E:9-170,E:293-366 [60705] Other proteins in same PDB: d1h6va2, d1h6va3, d1h6vb2, d1h6vb3, d1h6vc2, d1h6vc3, d1h6vd2, d1h6vd3, d1h6ve2, d1h6ve3, d1h6vf2, d1h6vf3 complexed with fad, ndp has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1h6v (more details), 3 Å
SCOPe Domain Sequences for d1h6ve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ve1 c.3.1.5 (E:9-170,E:293-366) Mammalian thioredoxin reductase, N- and C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} ksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkk lmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvye naygkfigphkimatnnkgkekvysaerfliatgerprylgiXrdsctrtigletvgvki nektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcd
Timeline for d1h6ve1: