Lineage for d1h6vf3 (1h6v F:367-499)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528292Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2528293Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2528371Protein Mammalian thioredoxin reductase [64329] (1 species)
  7. 2528372Species Norway rat (Rattus norvegicus) [TaxId:10116] [64330] (1 PDB entry)
  8. 2528378Domain d1h6vf3: 1h6v F:367-499 [60710]
    Other proteins in same PDB: d1h6va1, d1h6va2, d1h6vb1, d1h6vb2, d1h6vc1, d1h6vc2, d1h6vd1, d1h6vd2, d1h6ve1, d1h6ve2, d1h6vf1, d1h6vf2
    complexed with fad, ndp

Details for d1h6vf3

PDB Entry: 1h6v (more details), 3 Å

PDB Description: mammalian thioredoxin reductase
PDB Compounds: (F:) thioredoxin reductase

SCOPe Domain Sequences for d1h6vf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6vf3 d.87.1.1 (F:367-499) Mammalian thioredoxin reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvi
cnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtk
rsggdilqsgccg

SCOPe Domain Coordinates for d1h6vf3:

Click to download the PDB-style file with coordinates for d1h6vf3.
(The format of our PDB-style files is described here.)

Timeline for d1h6vf3: