PDB entry 1g77

View 1g77 on RCSB PDB site
Description: x-ray structure of escherichia coli pyridoxine 5`-phosphate oxidase complexed with pyridoxal 5'-phosphate at 2.0 a resolution
Deposited on 2000-11-09, released 2000-11-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g77a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g77A (A:)
gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
drflyqrendawkidrlap