PDB entry 1fk6

View 1fk6 on RCSB PDB site
Description: structural basis of non-specific lipid binding in maize lipid-transfer protein complexes with alpha-linolenic acid revealed by high-resolution x-ray crystallography
Class: lipid transport
Keywords: protein-lipid complex, LIPID TRANSPORT
Deposited on 2000-08-09, released 2001-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: non-specific lipid transfer protein
  Species: Zea mays [TaxId:4577]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19656 (0-92)
  Domains in SCOPe 2.06: d1fk6a_
• Heterogens: LNL, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fk6A (A:)
  aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
  sglnagnaasipskcgvsipytiststdcsrvn