Class a: All alpha proteins [46456] (289 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species) |
Species Maize (Zea mays) [TaxId:4577] [47706] (11 PDB entries) |
Domain d1fk6a_: 1fk6 A: [59867] complexed with fmt, lnl |
PDB Entry: 1fk6 (more details), 1.9 Å
SCOPe Domain Sequences for d1fk6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fk6a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]} aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv sglnagnaasipskcgvsipytiststdcsrvn
Timeline for d1fk6a_: