PDB entry 1fbr

View 1fbr on RCSB PDB site
Description: fourth and fifth fibronectin type i module pair
Deposited on 1995-08-08, released 1995-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbr_ (-)
    aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
    gdtwskkdnrgnllqcictgngrgewkcerhts