Lineage for d1fbr_1 (1fbr 1-46)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144450Fold g.27: Fibronectin type I module [57602] (1 superfamily)
  4. 144451Superfamily g.27.1: Fibronectin type I module [57603] (1 family) (S)
  5. 144452Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 144453Protein Fibronectin [57605] (1 species)
  7. 144454Species Human (Homo sapiens) [TaxId:9606] [57606] (5 PDB entries)
  8. 144455Domain d1fbr_1: 1fbr 1-46 [44948]

Details for d1fbr_1

PDB Entry: 1fbr (more details)

PDB Description: fourth and fifth fibronectin type i module pair

SCOP Domain Sequences for d1fbr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbr_1 g.27.1.1 (1-46) Fibronectin {Human (Homo sapiens)}
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

SCOP Domain Coordinates for d1fbr_1:

Click to download the PDB-style file with coordinates for d1fbr_1.
(The format of our PDB-style files is described here.)

Timeline for d1fbr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fbr_2