PDB entry 1ewh

View 1ewh on RCSB PDB site
Description: structure of cytochrome f from chlamydomonas reinhardtii
Class: electron transport
Keywords: beta sandwich, heme protein, electron transport
Deposited on 2000-04-25, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.187
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewha1, d1ewha2
  • Chain 'B':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewhb1, d1ewhb2
  • Chain 'C':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewhc1, d1ewhc2
  • Heterogens: ACT, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewhA (A:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewhB (B:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewhC (C:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar