SCOPe 2.08: Domain d1ewhb1: 1ewh B:1-168,B:233-251

Lineage for d1ewhb1 (1ewh B:1-168,B:233-251)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family)
Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
Protein Cytochrome f, large domain [49443] (5 species)
this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries)
Domain d1ewhb1: 1ewh B:1-168,B:233-251 [22475]
Other proteins in same PDB: d1ewha2, d1ewhb2, d1ewhc2
complexed with act, hec

Details for d1ewhb1

PDB Entry: 1ewh (more details), 2.35 Å

PDB Description: structure of cytochrome f from chlamydomonas reinhardtii

PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d1ewhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewhb1 b.2.6.1 (B:1-168,B:233-251) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar

SCOPe Domain Coordinates for d1ewhb1:

Click to download the PDB-style file with coordinates for d1ewhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ewhb1: