Lineage for d1ewhc2 (1ewh C:169-232)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. Protein Cytochrome f, small domain [51257] (5 species)
  7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)
  8. Domain d1ewhc2: 1ewh C:169-232 [28262]
    Other proteins in same PDB: d1ewha1, d1ewhb1, d1ewhc1
    complexed with act, hec

Details for d1ewhc2

PDB Entry: 1ewh (more details), 2.3499999999999996 Å

PDB Description: structure of cytochrome f from chlamydomonas reinhardtii
PDB Compounds: (C:) cytochrome f

SCOPe Domain Sequences for d1ewhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewhc2 b.84.2.2 (C:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOPe Domain Coordinates for d1ewhc2 are not available.

Timeline for d1ewhc2:

Domains from same chain:
(mouse over for more information)
d1ewhc1
Domains from other chains:
(mouse over for more information)
d1ewha1, d1ewha2, d1ewhb1, d1ewhb2