PDB entry 1ev4

View 1ev4 on RCSB PDB site
Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound
Class: transferase
Keywords: disordered C-terminal helices, TRANSFERASE
Deposited on 2000-04-19, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00502 (0-220)
      • engineered (19)
      • conflict (94)
      • engineered (218)
    Domains in SCOPe 2.07: d1ev4a1, d1ev4a2
  • Chain 'C':
    Compound: glutathione s-transferase a1-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00502 (0-End)
      • engineered (19)
      • conflict (94)
    Domains in SCOPe 2.07: d1ev4c1, d1ev4c2
  • Chain 'D':
    Compound: glutathione s-transferase a1-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00502 (0-220)
      • engineered (19)
      • conflict (94)
      • engineered (218)
    Domains in SCOPe 2.07: d1ev4d1, d1ev4d2
  • Heterogens: SO4, GTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev4A (A:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkiykf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ev4C (C:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkiykf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev4C (C:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev4D (D:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkiykf