Lineage for d1ev4d1 (1ev4 D:80-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712981Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries)
  8. 2712984Domain d1ev4d1: 1ev4 D:80-222 [17695]
    Other proteins in same PDB: d1ev4a2, d1ev4c2, d1ev4d2
    complexed with gts, so4; mutant

Details for d1ev4d1

PDB Entry: 1ev4 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound
PDB Compounds: (D:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1ev4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev4d1 a.45.1.1 (D:80-222) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkiykf

SCOPe Domain Coordinates for d1ev4d1:

Click to download the PDB-style file with coordinates for d1ev4d1.
(The format of our PDB-style files is described here.)

Timeline for d1ev4d1: