PDB entry 1etd

View 1etd on RCSB PDB site
Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix dna binding motif
Deposited on 1995-03-22, released 1996-01-29
The last revision prior to the SCOP 1.55 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1etd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1etd_ (-)
  iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
  yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad