PDB entry 1est

View 1est on RCSB PDB site
Description: the atomic structure of crystalline porcine pancreatic elastase at 2.5 angstroms resolution. comparisons with the structure of alpha-chymotrypsin
Deposited on 1976-05-17, released 1976-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1987-10-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1est__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1est_ (-)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn