PDB entry 1eo3

View 1eo3 on RCSB PDB site
Description: inhibition of ecorv endonuclease by deoxyribo-3'-s-phosphorothiolates: a high resolution x-ray crystallographic study
Class: hydrolase/DNA
Keywords: Protein-DNA complex, restriction endonuclease, DNA analog, hydrolase/DNA COMPLEX
Deposited on 2000-03-21, released 2000-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme EcoRV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eo3a_
  • Chain 'B':
    Compound: Type II restriction enzyme EcoRV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eo3b_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*ap*gp*ap*(tsp)p*ap*tp*cp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*ap*ap*gp*ap*(tsp)p*ap*tp*cp*tp*t)-3')
  • Heterogens: MG, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eo3A (A:)
    mslrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhg
    yiveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkn
    ivypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdl
    agsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwi
    yrgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo3A (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatksslktynilneipkpykgvkvflqdkwviagdlagsg
    nttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eo3B (B:)
    mslrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhg
    yiveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkn
    ivypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdl
    agsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwi
    yrgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo3B (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnekikftlggytsfirnntknivyp
    fdqyiahwiigyvytrvslktyninelneipkpykgvkvflqdkwviagdlagsgnttni
    gsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.