Lineage for d1eo3a_ (1eo3 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. Domain d1eo3a_: 1eo3 A: [33260]
    protein/DNA complex; complexed with acy, mg

Details for d1eo3a_

PDB Entry: 1eo3 (more details), 2 Å

PDB Description: inhibition of ecorv endonuclease by deoxyribo-3'-s-phosphorothiolates: a high resolution x-ray crystallographic study
PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1eo3a_:

Sequence, based on SEQRES records: (download)

>d1eo3a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d1eo3a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatksslktynilneipkpykgvkvflqdkwviagdlagsg
nttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
k

SCOPe Domain Coordinates for d1eo3a_ are not available.

Timeline for d1eo3a_:

Domains from other chains:
(mouse over for more information)
d1eo3b_