PDB entry 1ees

View 1ees on RCSB PDB site
Description: solution structure of cdc42hs complexed with a peptide derived from p- 21 activated kinase, nmr, 20 structures
Deposited on 2000-02-02, released 2000-03-29
The last revision prior to the SCOP 1.63 freeze date was dated 2000-04-12, with a file datestamp of 2000-04-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1eesa_
  • Chain 'B':
    Domains in SCOP 1.63: d1eesb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eesA (A:)
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eesB (B:)
gskerpeislpsdfehtihvgfdavtgeftgipeqwarllqtsnit