SCOP 1.63: Domain d1eesa_: 1ees A:

Lineage for d1eesa_ (1ees A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (15 PDB entries)

8. Domain d1eesa_: 1ees A: [32073]
   Other proteins in same PDB: d1eesb_

Details for d1eesa_

PDB Entry: 1ees

PDB Description: solution structure of cdc42hs complexed with a peptide derived from p- 21 activated kinase, nmr, 20 structures

SCOP Domain Sequences for d1eesa_:

Sequence; same for both SEQRES and ATOM records:

>d1eesa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

Timeline for d1eesa_:

• d1eesa_ first appeared (with stable ids) in SCOP 1.55
  
• d1eesa_ appears in SCOP 1.61
  
• d1eesa_ appears in SCOP 1.65
  
• d1eesa_ appears in the current release, SCOPe 2.08