PDB entry 1e47

View 1e47 on RCSB PDB site
Description: l-fuculose 1-phosphate aldolase from escherichia coli mutant e73q
Deposited on 2000-06-30, released 2000-11-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-06, with a file datestamp of 2000-11-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.15
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Domains in SCOP 1.55: d1e47p_

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e47P (P:)
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssqwrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf