PDB entry 1e2f

View 1e2f on RCSB PDB site
Description: human thymidylate kinase complexed with thymidine monophosphate, adenosine diphosphate and a magnesium-ion
Deposited on 2000-05-22, released 2001-05-17
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-17, with a file datestamp of 2001-05-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1e2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e2fA (A:)
arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdv
glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
sieavhedirvlsedaiatatekplgelwk