Lineage for d1e2fa_ (1e2f A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121798Protein Thymidylate kinase [52563] (4 species)
  7. 121815Species Human (Homo sapiens) [TaxId:9606] [64010] (13 PDB entries)
  8. 121819Domain d1e2fa_: 1e2f A: [59164]

Details for d1e2fa_

PDB Entry: 1e2f (more details), 1.6 Å

PDB Description: human thymidylate kinase complexed with thymidine monophosphate, adenosine diphosphate and a magnesium-ion

SCOP Domain Sequences for d1e2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdv
glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
sieavhedirvlsedaiatatekplgelwk

SCOP Domain Coordinates for d1e2fa_:

Click to download the PDB-style file with coordinates for d1e2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1e2fa_: