PDB entry 1dvu

View 1dvu on RCSB PDB site
Description: crystal structure of human transthyretin in complex with dibenzofuran-4,6-dicarboxylic acid
Deposited on 2000-01-22, released 2001-01-22
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-22, with a file datestamp of 2001-01-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dvua_
  • Chain 'B':
    Domains in SCOP 1.55: d1dvub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvuA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvuB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt