PDB entry 1dl6

View 1dl6 on RCSB PDB site
Description: solution structure of human tfiib n-terminal domain
Deposited on 1999-12-08, released 2000-10-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dl6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dl6A (A:)
    astsrldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndk