PDB entry 1deb

View 1deb on RCSB PDB site
Description: crystal structure of the n-terminal coiled coil domain from apc
Deposited on 1999-11-14, released 2000-09-01
The last revision was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenomatous polyposis coli protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: adenomatous polyposis coli protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1debA (A:)
aaasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1debB (B:)
aaasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi

    Sequence, based on observed residues (ATOM records):
    >1debB (B:)
aasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi