PDB entry 1d6r

View 1d6r on RCSB PDB site
Description: crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity
Deposited on 1999-10-15, released 2000-05-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-05, with a file datestamp of 2000-05-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.152
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d6ra_
  • Chain 'I':
    Domains in SCOP 1.55: d1d6ri_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d6rA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d6rI (I:)
kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck