PDB entry 1czy

View 1czy on RCSB PDB site
Description: crystal structure of the complex between the traf domain of human traf2 and an lmp1 binding peptide
Class: apoptosis
Keywords: beta sandwich, protein-peptide complex, signaling protein, apoptosis
Deposited on 1999-09-07, released 2000-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1czya1, d1czya2
  • Chain 'B':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1czyb1, d1czyb2
  • Chain 'C':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1czyc1, d1czyc2
  • Chain 'D':
    Compound: latent membrane protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: latent membrane protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1czyA (A:)
amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1czyB (B:)
amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1czyC (C:)
amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.