PDB entry 1czy
View 1czy on RCSB PDB site
Description: crystal structure of the complex between the traf domain of human traf2 and an lmp1 binding peptide
Class: apoptosis
Keywords: beta sandwich, protein-peptide complex, signaling protein, apoptosis
Deposited on
1999-09-07, released
2000-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1czya1, d1czya2 - Chain 'B':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1czyb1, d1czyb2 - Chain 'C':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1czyc1, d1czyc2 - Chain 'D':
Compound: latent membrane protein 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: latent membrane protein 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1czyA (A:)
amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1czyB (B:)
amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1czyC (C:)
amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.