Lineage for d1czyc1 (1czy C:350-501)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045537Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045538Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2045539Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2045555Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 2045556Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 2045559Domain d1czyc1: 1czy C:350-501 [23222]
    Other proteins in same PDB: d1czya2, d1czyb2, d1czyc2

Details for d1czyc1

PDB Entry: 1czy (more details), 2 Å

PDB Description: crystal structure of the complex between the traf domain of human traf2 and an lmp1 binding peptide
PDB Compounds: (C:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1czyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czyc1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1czyc1:

Click to download the PDB-style file with coordinates for d1czyc1.
(The format of our PDB-style files is described here.)

Timeline for d1czyc1: