PDB entry 1cy5

View 1cy5 on RCSB PDB site
Description: crystal structure of the apaf-1 card
Deposited on 1999-08-31, released 1999-09-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-01, with a file datestamp of 1999-11-30.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.169
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cy5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cy5A (A:)
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipv