PDB entry 1cww

View 1cww on RCSB PDB site
Description: solution structure of the caspase recruitment domain (card) from apaf- 1
Deposited on 1999-08-26, released 2000-01-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-21, with a file datestamp of 2000-01-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1cwwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cwwA (A:)
  gplgsmdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraam
  likmilkkdndsyvsfynallhegykdlaallhdgipvvsss