PDB entry 1cmj

View 1cmj on RCSB PDB site
Description: crystal structures of ferric-no complexes of fungal nitric oxide reductase and their ser286 mutants at cryogenic temperature
Deposited on 1999-05-07, released 2000-03-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-24, with a file datestamp of 2000-04-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cmja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmjA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtatalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif