PDB entry 1ccq

View 1ccq on RCSB PDB site
Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
Deposited on 1999-03-02, released 1999-06-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-29, with a file datestamp of 1999-06-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ccqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccqA (A:)
    lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn