PDB entry 1cb9

View 1cb9 on RCSB PDB site
Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (major form).
Deposited on 1999-03-01, released 1999-06-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-12, with a file datestamp of 2000-05-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cb9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb9A (A:)
    lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn