PDB entry 1c8r

View 1c8r on RCSB PDB site
Description: bacteriorhodopsin d96n br state at 2.0 a resolution
Deposited on 1999-07-29, released 1999-10-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-21, with a file datestamp of .
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.127
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c8ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c8rA (A:)
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttpllllnlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
ligsegagivplnietllfmvldvsakvgfglillrsraifg