PDB entry 1c7u

View 1c7u on RCSB PDB site
Description: complex of the dna binding core domain of the transcription factor mef2a with a 20mer oligonucleotide
Deposited on 2000-03-17, released 2000-03-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c7ua_
  • Chain 'B':
    Domains in SCOP 1.55: d1c7ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7uA (A:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
    mdkvllkyteynep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7uB (B:)
    grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
    mdkvllkyteynep