PDB entry 1bxd

View 1bxd on RCSB PDB site
Description: nmr structure of the histidine kinase domain of the e. coli osmosensor envz
Deposited on 1998-10-02, released 1999-10-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-02, with a file datestamp of 1999-10-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bxda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bxdA (A:)
tgqempmemadlnavlgeviaaesgyereietalypgsievkmhplsikravanmvvnaa
rygngwikvssgtepnrawfqveddgpgiapeqrkhlfqpfvrgdsartisgtglglaiv
qrivdnhngmlelgtsergglsirawlpvpvtraqgttkeg