PDB entry 1blq

View 1blq on RCSB PDB site
Description: structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures
Deposited on 1998-07-19, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1blq__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1blq_ (-)
  asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
  iieevdedgsgtidfeeflvmmvrqmkeda